PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000244.1_g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 354aa    MW: 40498.2 Da    PI: 6.8334
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000244.1_g00012.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1806.1e-5671361129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPtdeelv++yL+kk+++++++l +vik+vd+yk+ePwdL++  ++ + e++ewyfFs++dkky+tg+r+nrat++g+W
  Itr_sc000244.1_g00012.1   7 VPPGFRFHPTDEELVDYYLRKKITSRRIDL-DVIKDVDLYKIEPWDLQElcRIGTeEQNEWYFFSHKDKKYPTGTRTNRATAAGFW 91 
                              69****************************.9***************954555442556*************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              katg+dk+++s k+ l+g++ktLvfykgrap+g+k+dW+mheyrle
  Itr_sc000244.1_g00012.1  92 KATGRDKAIYS-KHDLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                              ***********.8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-615156IPR003441NAC domain
PROSITE profilePS5100560.0717156IPR003441NAC domain
PfamPF023659.0E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MNSFAHVPPG FRFHPTDEEL VDYYLRKKIT SRRIDLDVIK DVDLYKIEPW DLQELCRIGT  60
EEQNEWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKAI YSKHDLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLESDPN GTPQEEGWVV CRVFKKRIAT MRRESEHDSP IWYDDQVSFM  180
PEMDSPTQQH PHASSGGRSS YAQFPYRCKK ELDLQYPPVH AAAGDHPQFL QLPLLESPNK  240
LLHAPPGLTY APIPAFAGGH NIIHPMYVDN NNNNILGGHE HAAADHVTDW RVLDKFVASQ  300
LSQEELASKG PTTNYANAGD IFQTSDELNK QNPAPENAST SSSTSHHHQI DLWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-49715717166NO APICAL MERISTEM PROTEIN
1ut4_B6e-49715717166NO APICAL MERISTEM PROTEIN
1ut7_A6e-49715717166NO APICAL MERISTEM PROTEIN
1ut7_B6e-49715717166NO APICAL MERISTEM PROTEIN
3swm_A7e-49715720169NAC domain-containing protein 19
3swm_B7e-49715720169NAC domain-containing protein 19
3swm_C7e-49715720169NAC domain-containing protein 19
3swm_D7e-49715720169NAC domain-containing protein 19
3swp_A7e-49715720169NAC domain-containing protein 19
3swp_B7e-49715720169NAC domain-containing protein 19
3swp_C7e-49715720169NAC domain-containing protein 19
3swp_D7e-49715720169NAC domain-containing protein 19
4dul_A6e-49715717166NAC domain-containing protein 19
4dul_B6e-49715717166NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007038408.11e-168NAC domain protein, IPR003441
SwissprotQ9FWX21e-138NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A068UAL71e-168A0A068UAL7_COFCA; Uncharacterized protein
TrEMBLA0A061G7811e-168A0A061G781_THECC; NAC domain protein, IPR003441
STRINGVIT_16s0022g00690.t011e-165(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-126NAC 007